SCOPe 2.07: Domain d1prch2: 1prc H:1-36

Lineage for d1prch2 (1prc H:1-36)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
   synonym: blastochloris viridis

8. Domain d1prch2: 1prc H:1-36 [43445]
   Other proteins in same PDB: d1prcc_, d1prch1, d1prcl_, d1prcm_
   complexed with bcb, bpb, fe, hem, lda, mq7, ns1, so4, uq1

Details for d1prch2

PDB Entry: 1prc, 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1prch2:

Sequence; same for both SEQRES and ATOM records:

>d1prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d1prch2:

• d1prch2 first appeared (with stable ids) in SCOP 1.55
  
• d1prch2 appears in SCOPe 2.06
  
• d1prch2 appears in the current release, SCOPe 2.08