Lineage for d1prch2 (1prc H:1-36)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141805Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 141806Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 141892Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)
  8. 141902Domain d1prch2: 1prc H:1-36 [43445]
    Other proteins in same PDB: d1prcc_, d1prch1

Details for d1prch2

PDB Entry: 1prc (more details), 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

SCOP Domain Sequences for d1prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prch2 f.2.1.2 (H:1-36) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOP Domain Coordinates for d1prch2:

Click to download the PDB-style file with coordinates for d1prch2.
(The format of our PDB-style files is described here.)

Timeline for d1prch2: