SCOP 1.57: Domain d1prcm1: 1prc M:

Lineage for d1prcm1 (1prc M:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)

8. Domain d1prcm1: 1prc M: [43444]
   Other proteins in same PDB: d1prcc_, d1prch1

Details for d1prcm1

PDB Entry: 1prc, 2.3 Å

PDB Description: crystallographic refinement at 2.3 angstroms resolution and refined model of the photosynthetic reaction center from rhodopseudomonas viridis

SCOP Domain Sequences for d1prcm1:

Sequence; same for both SEQRES and ATOM records:

>d1prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d1prcm1:

• d1prcm1 first appeared (with stable ids) in SCOP 1.55
  
• d1prcm1 appears in SCOP 1.59
  
• d1prcm1 appears in the current release, SCOPe 2.08, called d1prcm_