SCOPe 2.03: Domain d5prch2: 5prc H:1-36

Lineage for d5prch2 (5prc H:1-36)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (15 PDB entries)
   synonym: blastochloris viridis

8. Domain d5prch2: 5prc H:1-36 [43442]
   Other proteins in same PDB: d5prcc_, d5prch1, d5prcl_, d5prcm_
   complexed with atz, bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d5prch2

PDB Entry: 5prc, 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d5prch2:

Sequence; same for both SEQRES and ATOM records:

>d5prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d5prch2:

• d5prch2 first appeared (with stable ids) in SCOP 1.55
  
• d5prch2 appears in SCOPe 2.02
  
• d5prch2 appears in SCOPe 2.04
  
• d5prch2 appears in the current release, SCOPe 2.08