Domain d5prcl_: 5prc L:

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

Lineage for d5prcl_ (5prc L:)

Root: SCOP 1.75B
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
five transmembrane helices forming a sheet-like structure
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
L and M are probably related to each other
Protein L (light) subunit [81477] (3 species)
Species Rhodopseudomonas viridis [TaxId:1079] [81474] (10 PDB entries)
Domain d5prcl_: 5prc L: [43440]
Other proteins in same PDB: d5prcc_, d5prch1, d5prch2, d5prcm_
complexed with atz, bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d5prcl_

PDB Entry: 5prc (more details)
PDB Description: photosynthetic reaction center from rhodopseudomonas viridis complex)
PDB Compounds: (L:) photosynthetic reaction center

SCOP Domain Sequences for d5prcl_:
Sequence; same for both SEQRES and ATOM records: (download)

>d5prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]} allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOP Domain Coordinates for d5prcl_:

Click to download the PDB-style file with coordinates for d5prcl_.
(The format of our PDB-style files is described here.)

Timeline for d5prcl_:
d5prcl_ appears in SCOP 1.75A

d5prcl_
(click for larger image)

d5prcl_ in context of chain

d5prcl_ in context of PDB
Domains from other chains:
d5prcc_, d5prch1, d5prch2, d5prcm_