SCOP 1.63: Domain d3prch2: 3prc H:1-36

Lineage for d3prch2 (3prc H:1-36)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries)

8. Domain d3prch2: 3prc H:1-36 [43439]
   Other proteins in same PDB: d3prcc_, d3prch1, d3prcl_, d3prcm_
   complexed with 7mq, bcb, bpb, fe2, hem, lda, ns5, so4

Details for d3prch2

PDB Entry: 3prc, 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (qb-depleted)

SCOP Domain Sequences for d3prch2:

Sequence; same for both SEQRES and ATOM records:

>d3prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d3prch2:

• d3prch2 first appeared (with stable ids) in SCOP 1.55
  
• d3prch2 appears in SCOP 1.61
  
• d3prch2 appears in SCOP 1.65
  
• d3prch2 appears in the current release, SCOPe 2.08