SCOPe 2.06: Domain d6prcl_: 6prc L:

Lineage for d6prcl_ (6prc L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (14 PDB entries)

8. Domain d6prcl_: 6prc L: [43434]
   Other proteins in same PDB: d6prcc_, d6prch1, d6prch2, d6prcm_
   complexed with bcb, bpb, ceb, fe2, hem, lda, mq7, ns5, so4

Details for d6prcl_

PDB Entry: 6prc, 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)

PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d6prcl_:

Sequence; same for both SEQRES and ATOM records:

>d6prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d6prcl_:

• d6prcl_ first appeared (with stable ids) in SCOP 1.55, called d6prcl1
  
• d6prcl_ appears in SCOPe 2.05
  
• d6prcl_ appears in SCOPe 2.07
  
• d6prcl_ appears in the current release, SCOPe 2.08