SCOP 1.63: Domain d6prcl_: 6prc L:

Lineage for d6prcl_ (6prc L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81474] (8 PDB entries)

8. Domain d6prcl_: 6prc L: [43434]
   Other proteins in same PDB: d6prcc_, d6prch1, d6prch2, d6prcm_
   complexed with 7mq, bcb, bpb, ceb, fe2, hem, lda, ns5, so4

Details for d6prcl_

PDB Entry: 6prc, 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)

SCOP Domain Sequences for d6prcl_:

Sequence; same for both SEQRES and ATOM records:

>d6prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d6prcl_:

• d6prcl_ first appeared (with stable ids) in SCOP 1.55, called d6prcl1
  
• d6prcl_ was called d6prcl1 in SCOP 1.61
  
• d6prcl_ appears in SCOP 1.65
  
• d6prcl_ appears in the current release, SCOPe 2.08