Lineage for d6prcl_ (6prc L:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227758Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2227759Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2227760Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. 2227761Protein L (light) subunit [81477] (3 species)
  7. 2227832Species Rhodopseudomonas viridis [TaxId:1079] [81474] (14 PDB entries)
  8. 2227834Domain d6prcl_: 6prc L: [43434]
    Other proteins in same PDB: d6prcc_, d6prch1, d6prch2, d6prcm_
    complexed with bcb, bpb, ceb, fe2, hem, lda, mq7, ns5, so4

Details for d6prcl_

PDB Entry: 6prc (more details), 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d6prcl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6prcl_ f.26.1.1 (L:) L (light) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

SCOPe Domain Coordinates for d6prcl_:

Click to download the PDB-style file with coordinates for d6prcl_.
(The format of our PDB-style files is described here.)

Timeline for d6prcl_: