Lineage for d1dxrh2 (1dxr H:1-36)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87638Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 87639Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 87725Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)
  8. 87726Domain d1dxrh2: 1dxr H:1-36 [43433]
    Other proteins in same PDB: d1dxrc_, d1dxrh1

Details for d1dxrh2

PDB Entry: 1dxr (more details), 2 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis - his l168 phe mutant (terbutryn complex)

SCOP Domain Sequences for d1dxrh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxrh2 f.2.1.2 (H:1-36) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOP Domain Coordinates for d1dxrh2:

Click to download the PDB-style file with coordinates for d1dxrh2.
(The format of our PDB-style files is described here.)

Timeline for d1dxrh2: