Lineage for d1qkoa_ (1qko A:)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (10 families) 
Family f.2.1.1: Seven-helix membrane receptors [56870] (3 proteins) Protein Bacteriorhodopsin [56871] (2 species) Species Halobacterium salinarum [TaxId:2242] [56873] (19 PDB entries) 
Domain d1qkoa_: 1qko A: [43414]
Details for d1qkoa_
PDB Entry: 1qko (more details), 2.1 Å
PDB Description: high resolution x-ray structure of an early intermediate in the bacteriorhodopsin photocycle
SCOP Domain Sequences for d1qkoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkoa_ f.2.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge
SCOP Domain Coordinates for d1qkoa_:
Click to download the PDB-style file with coordinates for d1qkoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qkoa_:
- d1qkoa_ appears in SCOP 1.57
- d1qkoa_ appears in the current release, SCOPe 2.08
View in 3D