Lineage for d1cwqb_ (1cwq B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3022997Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 3023002Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries)
    Uniprot P02945 17-245
  8. 3023059Domain d1cwqb_: 1cwq B: [43413]
    M intermediate structure (A) superimposed on the ground state structure (B)
    complexed with hex, oct, ret, trd, und

Details for d1cwqb_

PDB Entry: 1cwq (more details), 2.25 Å

PDB Description: m intermediate structure of the wild type bacteriorhodopsin in combination with the ground state structure
PDB Compounds: (B:) bacteriorhodopsin ("m" state intermediate in combination with ground state)

SCOPe Domain Sequences for d1cwqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwqb_ f.13.1.1 (B:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
aqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsml
lgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigt
glvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvl
wsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapeps

SCOPe Domain Coordinates for d1cwqb_:

Click to download the PDB-style file with coordinates for d1cwqb_.
(The format of our PDB-style files is described here.)

Timeline for d1cwqb_: