Lineage for d1c3wa_ (1c3w A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3022992Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 proteins)
  6. 3022997Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 3023002Species Halobacterium salinarum [TaxId:2242] [56873] (118 PDB entries)
    Uniprot P02945 17-245
  8. 3023022Domain d1c3wa_: 1c3w A: [43405]
    complexed with li1, ret, squ

Details for d1c3wa_

PDB Entry: 1c3w (more details), 1.55 Å

PDB Description: bacteriorhodopsin/lipid complex at 1.55 a resolution
PDB Compounds: (A:) bacteriorhodopsin (ground state wild type "br")

SCOPe Domain Sequences for d1c3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3wa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgfsmrpevastfkvlrnvtvvlwsaypvvw
ligsegagivplnietllfmvldvsakvgfglillrsraifg

SCOPe Domain Coordinates for d1c3wa_:

Click to download the PDB-style file with coordinates for d1c3wa_.
(The format of our PDB-style files is described here.)

Timeline for d1c3wa_: