Lineage for d1f16a_ (1f16 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626864Protein Proapoptotic molecule Bax [56862] (3 species)
  7. 2626865Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries)
  8. 2626873Domain d1f16a_: 1f16 A: [43400]

Details for d1f16a_

PDB Entry: 1f16 (more details)

PDB Description: solution structure of a pro-apoptotic protein bax
PDB Compounds: (A:) protein (apoptosis regulator bax, membrane isoform alpha)

SCOPe Domain Sequences for d1f16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f16a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
eclkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
vlkalctkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagv
ltasltiwkkmg

SCOPe Domain Coordinates for d1f16a_:

Click to download the PDB-style file with coordinates for d1f16a_.
(The format of our PDB-style files is described here.)

Timeline for d1f16a_: