SCOPe 2.03: Domain d1ddba_: 1ddb A:

Lineage for d1ddba_ (1ddb A:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Proapoptotic molecule Bid [56859] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56861] (1 PDB entry)

8. Domain d1ddba_: 1ddb A: [43399]

Details for d1ddba_

PDB Entry: 1ddb

PDB Description: structure of mouse bid, nmr, 20 structures

PDB Compounds: (A:) protein (bid)

SCOPe Domain Sequences for d1ddba_:

Sequence; same for both SEQRES and ATOM records:

>d1ddba_ f.1.4.1 (A:) Proapoptotic molecule Bid {Mouse (Mus musculus) [TaxId: 10090]}
mdsevsngsglgakhitdllvfgflqssgctrqelevlgrelpvqayweadledelqtdg
sqasrsfnqgriepdsesqeeiihniarhlaqigdemdhniqptlvrqlaaqfmngslse
edkrnclakaldevktafprdmendkamlimtmllakkvashapsllrdvfhttvnfinq
nlfsyvrnlvrnemd

Timeline for d1ddba_:

• d1ddba_ first appeared (with stable ids) in SCOP 1.55
  
• d1ddba_ appears in SCOPe 2.02
  
• d1ddba_ appears in SCOPe 2.04
  
• d1ddba_ appears in the current release, SCOPe 2.08