![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Proapoptotic molecule Bid [56859] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56860] (1 PDB entry) |
![]() | Domain d2bida_: 2bid A: [43398] |
PDB Entry: 2bid (more details)
SCOPe Domain Sequences for d2bida_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bida_ f.1.4.1 (A:) Proapoptotic molecule Bid {Human (Homo sapiens) [TaxId: 9606]} gsmdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelq tdgnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsr seedrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfi nqnlrtyvrslarngmd
Timeline for d2bida_: