SCOPe 2.02: Domain d2bida_: 2bid A:

Lineage for d2bida_ (2bid A:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Proapoptotic molecule Bid [56859] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56860] (1 PDB entry)

8. Domain d2bida_: 2bid A: [43398]

Details for d2bida_

PDB Entry: 2bid

PDB Description: human pro-apoptotic protein bid

PDB Compounds: (A:) protein (bid)

SCOPe Domain Sequences for d2bida_:

Sequence; same for both SEQRES and ATOM records:

>d2bida_ f.1.4.1 (A:) Proapoptotic molecule Bid {Human (Homo sapiens) [TaxId: 9606]}
gsmdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelq
tdgnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsr
seedrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfi
nqnlrtyvrslarngmd

Timeline for d2bida_:

• d2bida_ first appeared (with stable ids) in SCOP 1.55
  
• d2bida_ appears in SCOPe 2.01
  
• d2bida_ appears in SCOPe 2.03
  
• d2bida_ appears in the current release, SCOPe 2.08, called d2bida1