Lineage for d2bida_ (2bid A:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87529Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
  4. 87566Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
  5. 87567Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (4 proteins)
  6. 87583Protein Proapoptotic molecule Bid [56859] (2 species)
  7. 87584Species Human (Homo sapiens) [TaxId:9606] [56860] (1 PDB entry)
  8. 87585Domain d2bida_: 2bid A: [43398]

Details for d2bida_

PDB Entry: 2bid (more details)

PDB Description: human pro-apoptotic protein bid

SCOP Domain Sequences for d2bida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bida_ f.1.4.1 (A:) Proapoptotic molecule Bid {Human (Homo sapiens)}
gsmdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelq
tdgnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsr
seedrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfi
nqnlrtyvrslarngmd

SCOP Domain Coordinates for d2bida_:

Click to download the PDB-style file with coordinates for d2bida_.
(The format of our PDB-style files is described here.)

Timeline for d2bida_: