Lineage for d2bida_ (2bid A:)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) 
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) 
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (3 proteins) 
Protein Proapoptotic molecule Bid [56859] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56860] (1 PDB entry) 
Domain d2bida_: 2bid A: [43398]
Details for d2bida_
PDB Entry: 2bid (more details)
PDB Description: human pro-apoptotic protein bid
PDB Compounds: (A:) protein (bid)SCOP Domain Sequences for d2bida_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bida_ f.1.4.1 (A:) Proapoptotic molecule Bid {Human (Homo sapiens)}
gsmdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelq
tdgnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsr
seedrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfi
nqnlrtyvrslarngmd
SCOP Domain Coordinates for d2bida_:
Click to download the PDB-style file with coordinates for d2bida_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bida_:
- d2bida_ appears in SCOP 1.57
- d2bida_ appears in the current release, SCOPe 2.08, called d2bida1
View in 3D