SCOPe 2.06: Domain d1lxla1: 1lxl A:-3-209

Lineage for d1lxla1 (1lxl A:-3-209)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)

8. Domain d1lxla1: 1lxl A:-3-209 [43395]
   Other proteins in same PDB: d1lxla2

Details for d1lxla1

PDB Entry: 1lxl

PDB Description: nmr structure of bcl-xl, an inhibitor of programmed cell death, minimized average structure

PDB Compounds: (A:) bcl-xl

SCOPe Domain Sequences for d1lxla1:

Sequence; same for both SEQRES and ATOM records:

>d1lxla1 f.1.4.1 (A:-3-209) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgqer

Timeline for d1lxla1:

• d1lxla1 first appeared (with stable ids) in SCOP 1.55, called d1lxl__
  
• d1lxla1 was called d1lxla_ in SCOPe 2.05
  
• d1lxla1 appears in SCOPe 2.07
  
• d1lxla1 appears in the current release, SCOPe 2.08