Lineage for d1lxl__ (1lxl -)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619387Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 619427Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 619428Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (9 proteins)
    Pfam 00452
  6. 619433Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 619434Species Human (Homo sapiens) [TaxId:9606] [56857] (9 PDB entries)
  8. 619443Domain d1lxl__: 1lxl - [43395]

Details for d1lxl__

PDB Entry: 1lxl (more details)

PDB Description: nmr structure of bcl-xl, an inhibitor of programmed cell death, minimized average structure

SCOP Domain Sequences for d1lxl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxl__ f.1.4.1 (-) Apoptosis regulator Bcl-xL {Human (Homo sapiens)}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh

SCOP Domain Coordinates for d1lxl__:

Click to download the PDB-style file with coordinates for d1lxl__.
(The format of our PDB-style files is described here.)

Timeline for d1lxl__: