![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (8 proteins) |
![]() | Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56857] (9 PDB entries) |
![]() | Domain d1lxl__: 1lxl - [43395] |
PDB Entry: 1lxl (more details)
SCOP Domain Sequences for d1lxl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxl__ f.1.4.1 (-) Apoptosis regulator Bcl-xL {Human (Homo sapiens)} msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh
Timeline for d1lxl__: