Lineage for d1g5ja_ (1g5j A:)
- Root: SCOP 1.55
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) 
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) 
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (3 proteins) Protein Apoptosis regulator Bcl-xL [56856] (2 species) Species Human (Homo sapiens) [TaxId:9606] [56857] (4 PDB entries) 
Domain d1g5ja_: 1g5j A: [43394]
Details for d1g5ja_
PDB Entry: 1g5j (more details)
PDB Description: complex of bcl-xl with peptide from bad
SCOP Domain Sequences for d1g5ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ja_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens)}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerle
SCOP Domain Coordinates for d1g5ja_:
Click to download the PDB-style file with coordinates for d1g5ja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g5ja_:
- d1g5ja_ appears in SCOP 1.57
- d1g5ja_ appears in the current release, SCOPe 2.08, called d1g5ja1
View in 3D