Lineage for d1g5ja1 (1g5j A:5-213)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575217Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2575295Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2575296Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2575302Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2575303Species Human (Homo sapiens) [TaxId:9606] [56857] (36 PDB entries)
  8. 2575354Domain d1g5ja1: 1g5j A:5-213 [43394]
    Other proteins in same PDB: d1g5ja2, d1g5ja3
    complex with peptide from Bad (CH B)

Details for d1g5ja1

PDB Entry: 1g5j (more details)

PDB Description: complex of bcl-xl with peptide from bad
PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1g5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ja1 f.1.4.1 (A:5-213) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqer

SCOPe Domain Coordinates for d1g5ja1:

Click to download the PDB-style file with coordinates for d1g5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1g5ja1: