SCOP 1.75: Domain d1maza_: 1maz A:

Lineage for d1maza_ (1maz A:)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (10 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (15 PDB entries)

8. Domain d1maza_: 1maz A: [43393]

Details for d1maza_

PDB Entry: 1maz, 2.2 Å

PDB Description: x-ray structure of bcl-xl, an inhibitor of programmed cell death

PDB Compounds: (A:) bcl-xl

SCOP Domain Sequences for d1maza_:

Sequence, based on SEQRES records:

>d1maza_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelyg

Sequence, based on observed residues (ATOM records):

>d1maza_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfipmaavkqalreagdefelryrrafsdltsqlh
itpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmaty
lndhlepwiqenggwdtfvelyg

Timeline for d1maza_:

• d1maza_ first appeared (with stable ids) in SCOP 1.55, called d1maz__
  
• d1maza_ appears in SCOP 1.73
  
• d1maza_ appears in SCOPe 2.01
  
• d1maza_ appears in the current release, SCOPe 2.08