Lineage for d1ciya3 (1ciy A:33-255)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626637Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) (S)
    automatically mapped to Pfam PF03945
  5. 2626638Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins)
    seven-helical bundle with central helix surrounded by six others
  6. 2626639Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species)
  7. 2626648Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [56853] (1 PDB entry)
  8. 2626649Domain d1ciya3: 1ciy A:33-255 [43392]
    Other proteins in same PDB: d1ciya1, d1ciya2

Details for d1ciya3

PDB Entry: 1ciy (more details), 2.25 Å

PDB Description: insecticidal toxin: structure and channel formation
PDB Compounds: (A:) cryia(a)

SCOPe Domain Sequences for d1ciya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciya3 f.1.3.1 (A:33-255) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]}
ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa
rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaipllavqn
yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwyn
tglervwgpdsrdwvrynqfrreltltvldivalfsnydsrry

SCOPe Domain Coordinates for d1ciya3:

Click to download the PDB-style file with coordinates for d1ciya3.
(The format of our PDB-style files is described here.)

Timeline for d1ciya3: