Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) automatically mapped to Pfam PF03945 |
Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins) seven-helical bundle with central helix surrounded by six others |
Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species) |
Species Bacillus thuringiensis, CRYIA (A) [TaxId:1428] [56853] (1 PDB entry) |
Domain d1ciya3: 1ciy A:33-255 [43392] Other proteins in same PDB: d1ciya1, d1ciya2 |
PDB Entry: 1ciy (more details), 2.25 Å
SCOPe Domain Sequences for d1ciya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciya3 f.1.3.1 (A:33-255) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis, CRYIA (A) [TaxId: 1428]} ytpidislsltqfllsefvpgagfvlglvdiiwgifgpsqwdaflvqieqlinqrieefa rnqaisrleglsnlyqiyaesfreweadptnpalreemriqfndmnsalttaipllavqn yqvpllsvyvqaanlhlsvlrdvsvfgqrwgfdaatinsryndltrlignytdyavrwyn tglervwgpdsrdwvrynqfrreltltvldivalfsnydsrry
Timeline for d1ciya3: