| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.3: delta-Endotoxin (insectocide), N-terminal domain [56849] (2 families) ![]() automatically mapped to Pfam PF03945 |
| Family f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain [56850] (2 proteins) seven-helical bundle with central helix surrounded by six others |
| Protein delta-Endotoxin (insectocide), N-terminal domain [56851] (5 species) |
| Species Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId:1444] [56852] (1 PDB entry) |
| Domain d1dlca3: 1dlc A:61-289 [43391] Other proteins in same PDB: d1dlca1, d1dlca2 |
PDB Entry: 1dlc (more details), 2.5 Å
SCOPe Domain Sequences for d1dlca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dlca3 f.1.3.1 (A:61-289) delta-Endotoxin (insectocide), N-terminal domain {Bacillus thuringiensis tenebrionis, CRYIIIA (BT13) [TaxId: 1444]}
ttkdviqkgisvvgdllgvvgfpfggalvsfytnflntiwpsedpwkafmeqvealmdqk
iadyaknkalaelqglqnnvedyvsalsswqknpvssrnphsqgrirelfsqaeshfrns
mpsfaisgyevlflttyaqaanthlfllkdaqiygeewgyekediaefykrqlkltqeyt
dhcvkwynvgldklrgssyeswvnfnryrremtltvldlialfplydvr
Timeline for d1dlca3: