Lineage for d1xdtt3 (1xdt T:200-380)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38778Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
  4. 38791Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family) (S)
  5. 38792Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)
  6. 38793Protein Diphtheria toxin, middle domain [56847] (1 species)
  7. 38794Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries)
  8. 38803Domain d1xdtt3: 1xdt T:200-380 [43390]
    Other proteins in same PDB: d1xdtr_, d1xdtt1, d1xdtt2

Details for d1xdtt3

PDB Entry: 1xdt (more details), 2.65 Å

PDB Description: complex of diphtheria toxin and heparin-binding epidermal growth factor

SCOP Domain Sequences for d1xdtt3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdtt3 f.1.2.1 (T:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

SCOP Domain Coordinates for d1xdtt3:

Click to download the PDB-style file with coordinates for d1xdtt3.
(The format of our PDB-style files is described here.)

Timeline for d1xdtt3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xdtr_