SCOP 1.69: Domain d1sgk_3: 1sgk 200-380

Lineage for d1sgk_3 (1sgk 200-380)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family)

5. Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)

6. Protein Diphtheria toxin, middle domain [56847] (1 species)
   contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)

7. Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries)

8. Domain d1sgk_3: 1sgk 200-380 [43385]
   Other proteins in same PDB: d1sgk_1, d1sgk_2

Details for d1sgk_3

PDB Entry: 1sgk, 2.3 Å

PDB Description: nucleotide-free diphtheria toxin

SCOP Domain Sequences for d1sgk_3:

Sequence; same for both SEQRES and ATOM records:

>d1sgk_3 f.1.2.1 (200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Timeline for d1sgk_3:

• d1sgk_3 first appeared (with stable ids) in SCOP 1.55
  
• d1sgk_3 appears in SCOP 1.67
  
• d1sgk_3 appears in SCOP 1.71
  
• d1sgk_3 appears in the current release, SCOPe 2.08, called d1sgka3