| Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
| Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (1 family) ![]() |
| Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein) |
| Protein Diphtheria toxin, middle domain [56847] (1 species) contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A) |
| Species Corynebacterium diphtheriae [TaxId:1717] [56848] (6 PDB entries) |
| Domain d1sgk_3: 1sgk 200-380 [43385] Other proteins in same PDB: d1sgk_1, d1sgk_2 |
PDB Entry: 1sgk (more details), 2.3 Å
SCOP Domain Sequences for d1sgk_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgk_3 f.1.2.1 (200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y
Timeline for d1sgk_3: