Lineage for d1f0lb3 (1f0l B:201-380)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021051Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 3021052Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein)
  6. 3021053Protein Diphtheria toxin, middle domain [56847] (1 species)
    contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A)
  7. 3021054Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries)
  8. 3021056Domain d1f0lb3: 1f0l B:201-380 [43383]
    Other proteins in same PDB: d1f0la1, d1f0la2, d1f0lb1, d1f0lb2
    complexed with apu, cl

Details for d1f0lb3

PDB Entry: 1f0l (more details), 1.55 Å

PDB Description: 1.55 angstrom crystal structure of wild type diphtheria toxin
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d1f0lb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0lb3 f.1.2.1 (B:201-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]}
cinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpel
selktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadga
vhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpay

SCOPe Domain Coordinates for d1f0lb3:

Click to download the PDB-style file with coordinates for d1f0lb3.
(The format of our PDB-style files is described here.)

Timeline for d1f0lb3: