Lineage for d1dwub_ (1dwu B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249705Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 2249706Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 2249707Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 2249708Protein Ribosomal protein L1 [56810] (4 species)
  7. 2249714Species Methanococcus thermolithotrophicus [TaxId:2186] [56813] (1 PDB entry)
  8. 2249716Domain d1dwub_: 1dwu B: [43356]

Details for d1dwub_

PDB Entry: 1dwu (more details), 2.8 Å

PDB Description: ribosomal protein l1
PDB Compounds: (B:) ribosomal protein l1

SCOPe Domain Sequences for d1dwub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwub_ e.24.1.1 (B:) Ribosomal protein L1 {Methanococcus thermolithotrophicus [TaxId: 2186]}
mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki
aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg
pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea
ilntvsrkyekglyhvksaytkltmgppaqiek

SCOPe Domain Coordinates for d1dwub_:

Click to download the PDB-style file with coordinates for d1dwub_.
(The format of our PDB-style files is described here.)

Timeline for d1dwub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dwua_