SCOPe 2.03: Domain d1dwub_: 1dwu B:

Lineage for d1dwub_ (1dwu B:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
   2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)

4. Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family)
   automatically mapped to Pfam PF00687

5. Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)

6. Protein Ribosomal protein L1 [56810] (4 species)

7. Species Methanococcus thermolithotrophicus [TaxId:2186] [56813] (1 PDB entry)

8. Domain d1dwub_: 1dwu B: [43356]

Details for d1dwub_

PDB Entry: 1dwu, 2.8 Å

PDB Description: ribosomal protein l1

PDB Compounds: (B:) ribosomal protein l1

SCOPe Domain Sequences for d1dwub_:

Sequence; same for both SEQRES and ATOM records:

>d1dwub_ e.24.1.1 (B:) Ribosomal protein L1 {Methanococcus thermolithotrophicus [TaxId: 2186]}
mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki
aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg
pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea
ilntvsrkyekglyhvksaytkltmgppaqiek

Timeline for d1dwub_:

• d1dwub_ first appeared (with stable ids) in SCOP 1.55
  
• d1dwub_ appears in SCOPe 2.02
  
• d1dwub_ appears in SCOPe 2.04
  
• d1dwub_ appears in the current release, SCOPe 2.08