![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
![]() | Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) ![]() automatically mapped to Pfam PF00687 |
![]() | Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
![]() | Protein Ribosomal protein L1 [56810] (4 species) |
![]() | Species Methanococcus thermolithotrophicus [TaxId:2186] [56813] (1 PDB entry) |
![]() | Domain d1dwub_: 1dwu B: [43356] |
PDB Entry: 1dwu (more details), 2.8 Å
SCOPe Domain Sequences for d1dwub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwub_ e.24.1.1 (B:) Ribosomal protein L1 {Methanococcus thermolithotrophicus [TaxId: 2186]} mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea ilntvsrkyekglyhvksaytkltmgppaqiek
Timeline for d1dwub_: