Lineage for d1dwua_ (1dwu A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38724Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
  4. 38725Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
  5. 38726Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 38727Protein Ribosomal protein L1 [56810] (3 species)
  7. 38730Species Methanococcus thermolithotrophicus [TaxId:2186] [56813] (1 PDB entry)
  8. 38731Domain d1dwua_: 1dwu A: [43355]

Details for d1dwua_

PDB Entry: 1dwu (more details), 2.8 Å

PDB Description: ribosomal protein l1

SCOP Domain Sequences for d1dwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwua_ e.24.1.1 (A:) Ribosomal protein L1 {Methanococcus thermolithotrophicus}
mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki
aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg
pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea
ilntvsrkyekglyhvksaytkltmgppaqiek

SCOP Domain Coordinates for d1dwua_:

Click to download the PDB-style file with coordinates for d1dwua_.
(The format of our PDB-style files is described here.)

Timeline for d1dwua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dwub_