Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) |
Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) |
Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) |
Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
Protein Ribosomal protein L1 [56810] (3 species) |
Species Methanococcus thermolithotrophicus [TaxId:2186] [56813] (1 PDB entry) |
Domain d1dwua_: 1dwu A: [43355] |
PDB Entry: 1dwu (more details), 2.8 Å
SCOP Domain Sequences for d1dwua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwua_ e.24.1.1 (A:) Ribosomal protein L1 {Methanococcus thermolithotrophicus} mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea ilntvsrkyekglyhvksaytkltmgppaqiek
Timeline for d1dwua_: