Lineage for d1fezb_ (1fez B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167045Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2167046Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)
  7. 2167047Species Bacillus cereus [TaxId:1396] [56794] (6 PDB entries)
    Uniprot O31156
  8. 2167063Domain d1fezb_: 1fez B: [43344]
    complexed with mg, wo4

Details for d1fezb_

PDB Entry: 1fez (more details), 3 Å

PDB Description: the crystal structure of bacillus cereus phosphonoacetaldehyde hydrolase complexed with tungstate, a product analog
PDB Compounds: (B:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d1fezb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fezb_ c.108.1.3 (B:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmgllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspinavkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehie

SCOPe Domain Coordinates for d1fezb_:

Click to download the PDB-style file with coordinates for d1fezb_.
(The format of our PDB-style files is described here.)

Timeline for d1fezb_: