SCOPe 2.06: Domain d1ek2b1: 1ek2 B:4-225

Lineage for d1ek2b1 (1ek2 B:4-225)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: YihX-like [56789] (3 proteins)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF13419

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries)

8. Domain d1ek2b1: 1ek2 B:4-225 [43342]
   Other proteins in same PDB: d1ek2a2, d1ek2b2
   complexed with cdu

Details for d1ek2b1

PDB Entry: 1ek2, 3 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor

PDB Compounds: (B:) epoxide hydrolase

SCOPe Domain Sequences for d1ek2b1:

Sequence; same for both SEQRES and ATOM records:

>d1ek2b1 c.108.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap

Timeline for d1ek2b1:

• d1ek2b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ek2b1 appears in SCOPe 2.05
  
• d1ek2b1 appears in SCOPe 2.07
  
• d1ek2b1 appears in the current release, SCOPe 2.08