| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (10 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein) the insertion subdomain is a 4-helical bundle |
| Protein Epoxide hydrolase, N-terminal domain [56790] (1 species) has a lipid phosphatase activity |
| Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries) |
| Domain d1cr6b1: 1cr6 B:4-225 [43338] Other proteins in same PDB: d1cr6a2, d1cr6b2 |
PDB Entry: 1cr6 (more details), 2.8 Å
SCOP Domain Sequences for d1cr6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cr6b1 c.108.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus)}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap
Timeline for d1cr6b1: