Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.2: YihX-like [56789] (3 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
Protein Epoxide hydrolase, N-terminal domain [56790] (2 species) has a lipid phosphatase activity |
Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries) |
Domain d1ek1b1: 1ek1 B:4-225 [43336] Other proteins in same PDB: d1ek1a2, d1ek1b2 complexed with ciu |
PDB Entry: 1ek1 (more details), 3.1 Å
SCOPe Domain Sequences for d1ek1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ek1b1 c.108.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap
Timeline for d1ek1b1: