Lineage for d1ek1b1 (1ek1 B:4-225)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2166939Family c.108.1.2: YihX-like [56789] (3 proteins)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 2166940Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 2166977Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries)
  8. 2166983Domain d1ek1b1: 1ek1 B:4-225 [43336]
    Other proteins in same PDB: d1ek1a2, d1ek1b2
    complexed with ciu

Details for d1ek1b1

PDB Entry: 1ek1 (more details), 3.1 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor
PDB Compounds: (B:) epoxide hydrolase

SCOPe Domain Sequences for d1ek1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek1b1 c.108.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap

SCOPe Domain Coordinates for d1ek1b1:

Click to download the PDB-style file with coordinates for d1ek1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ek1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ek1b2