SCOP 1.69: Domain d1ek1b1: 1ek1 B:4-225

Lineage for d1ek1b1 (1ek1 B:4-225)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (16 families)
   contains an insert alpha+beta subdomain; similar overall fold to the Cof family
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
   the insertion subdomain is a 4-helical bundle

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries)

8. Domain d1ek1b1: 1ek1 B:4-225 [43336]
   Other proteins in same PDB: d1ek1a2, d1ek1b2

Details for d1ek1b1

PDB Entry: 1ek1, 3.1 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor

SCOP Domain Sequences for d1ek1b1:

Sequence; same for both SEQRES and ATOM records:

>d1ek1b1 c.108.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus)}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap

Timeline for d1ek1b1:

• d1ek1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ek1b1 appears in SCOP 1.67
  
• d1ek1b1 appears in SCOP 1.71
  
• d1ek1b1 appears in the current release, SCOPe 2.08