Lineage for d1ek1b1 (1ek1 B:4-225)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38670Fold e.21: HAD-like [56783] (1 superfamily)
  4. 38671Superfamily e.21.1: HAD-like [56784] (3 families) (S)
  5. 38688Family e.21.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
  6. 38689Protein Epoxide hydrolase, N-terminal domain [56790] (1 species)
  7. 38690Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries)
  8. 38692Domain d1ek1b1: 1ek1 B:4-225 [43336]
    Other proteins in same PDB: d1ek1a2, d1ek1b2

Details for d1ek1b1

PDB Entry: 1ek1 (more details), 2 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor

SCOP Domain Sequences for d1ek1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek1b1 e.21.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus)}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap

SCOP Domain Coordinates for d1ek1b1:

Click to download the PDB-style file with coordinates for d1ek1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ek1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ek1b2