SCOP 1.55: Domain d1qq7a_: 1qq7 A:

Lineage for d1qq7a_ (1qq7 A:)

1. Root: SCOP 1.55

2. Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)

3. Fold e.21: HAD-like [56783] (1 superfamily)

4. Superfamily e.21.1: HAD-like [56784] (3 families)

5. Family e.21.1.1: L-2-Haloacid dehalogenase, HAD [56785] (1 protein)

6. Protein L-2-Haloacid dehalogenase, HAD [56786] (2 species)

7. Species Xanthobacter autotrophicus [56788] (4 PDB entries)

8. Domain d1qq7a_: 1qq7 A: [43329]

Details for d1qq7a_

PDB Entry: 1qq7, 1.7 Å

PDB Description: structure of l-2-haloacid dehalogenase from xanthobacter autotrophicus with chloropropionic acid covalently bound

SCOP Domain Sequences for d1qq7a_:

Sequence; same for both SEQRES and ATOM records:

>d1qq7a_ e.21.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus}
mikavvfdaygtlfdvqsvadateraypgrgeyitqvwrqkqleyswlralmgryadfws
vtrealaytlgtlglepdesfladmaqaynrltpypdaaqclaelaplkrailsngapdm
lqalvanagltdsfdavisvdakrvfkphpdsyalveevlgvtpaevlfvssngfdvgga
knfgfsvarvarlsqealarelvsgtiapltmfkalrmreetyaeapdfvvpalgdlprl
vrgma

Timeline for d1qq7a_:

• d1qq7a_ appears in SCOP 1.57
  
• d1qq7a_ appears in the current release, SCOPe 2.08