Lineage for d2bpr__ (2bpr -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383472Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 383473Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 383474Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (1 protein)
  6. 383475Protein DnaK [100922] (2 species)
  7. 383476Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 383484Domain d2bpr__: 2bpr - [43320]

Details for d2bpr__

PDB Entry: 2bpr (more details)

PDB Description: nmr structure of the substrate binding domain of dnak, 25 structures

SCOP Domain Sequences for d2bpr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpr__ b.130.1.1 (-) DnaK {Escherichia coli}
siegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
ikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveea

SCOP Domain Coordinates for d2bpr__:

Click to download the PDB-style file with coordinates for d2bpr__.
(The format of our PDB-style files is described here.)

Timeline for d2bpr__: