Lineage for d1dg4a_ (1dg4 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 473040Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 473041Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 473042Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (1 protein)
  6. 473043Protein DnaK [100922] (2 species)
  7. 473044Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 473050Domain d1dg4a_: 1dg4 A: [43318]

Details for d1dg4a_

PDB Entry: 1dg4 (more details)

PDB Description: nmr structure of the substrate binding domain of dnak in the apo form

SCOP Domain Sequences for d1dg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg4a_ b.130.1.1 (A:) DnaK {Escherichia coli}
lslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkraadnkslgq
fnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassgl

SCOP Domain Coordinates for d1dg4a_:

Click to download the PDB-style file with coordinates for d1dg4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dg4a_: