SCOPe 2.07: Domain d1frfs_: 1frf S:

Lineage for d1frfs_ (1frf S:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)

7. Species Desulfovibrio fructosovorans [TaxId:878] [56775] (1 PDB entry)

8. Domain d1frfs_: 1frf S: [43312]
   Other proteins in same PDB: d1frfl_
   complexed with f3s, fe, mg, ni, sf4

Details for d1frfs_

PDB Entry: 1frf, 2.7 Å

PDB Description: crystal structure of the ni-fe hydrogenase from desulfovibrio fructosovorans

PDB Compounds: (S:) [ni-fe] hydrogenase

SCOPe Domain Sequences for d1frfs_:

Sequence; same for both SEQRES and ATOM records:

>d1frfs_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfovibrio fructosovorans [TaxId: 878]}
khrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaagetseaalhea
legkdgyylvvegglptidggqwgmvaghpmietckkaaakakgiicigtcspyggvqka
kpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelv
hdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqagh
pclgcsepdfwdtmtpfyeqg

Timeline for d1frfs_:

• d1frfs_ first appeared (with stable ids) in SCOP 1.55
  
• d1frfs_ appears in SCOPe 2.06
  
• d1frfs_ appears in the current release, SCOPe 2.08