Lineage for d1frvc_ (1frv C:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624629Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2624630Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 2624638Species Desulfovibrio gigas [TaxId:879] [56773] (2 PDB entries)
  8. 2624646Domain d1frvc_: 1frv C: [43309]
    Other proteins in same PDB: d1frvb_, d1frvd_
    complexed with f3s, fel, ni, sf4

Details for d1frvc_

PDB Entry: 1frv (more details), 2.85 Å

PDB Description: crystal structure of the oxidized form of ni-fe hydrogenase
PDB Compounds: (C:) hydrogenase

SCOPe Domain Sequences for d1frvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1frvc_ e.19.1.1 (C:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}
akkrpsvvylhnaectgcsesllrtvdpyvdelildvismdyhetlmagaghaveealhe
aikgdfvcvieggipmgdggywgkvgrrnmydicaevapkakaviaigtcatyggvqaak
pnptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffge
tvhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqa
ghpciacsepnfwdlyspfysa

SCOPe Domain Coordinates for d1frvc_:

Click to download the PDB-style file with coordinates for d1frvc_.
(The format of our PDB-style files is described here.)

Timeline for d1frvc_: