Lineage for d2frvi_ (2frv I:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 518564Fold e.19: Nickel-iron hydrogenase, small subunit [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 518565Superfamily e.19.1: Nickel-iron hydrogenase, small subunit [56770] (1 family) (S)
  5. 518566Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein)
  6. 518567Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 518575Species Desulfovibrio gigas [TaxId:879] [56773] (2 PDB entries)
  8. 518582Domain d2frvi_: 2frv I: [43307]
    Other proteins in same PDB: d2frvb_, d2frvd_, d2frvf_, d2frvh_, d2frvj_, d2frvl_

Details for d2frvi_

PDB Entry: 2frv (more details), 2.54 Å

PDB Description: crystal structure of the oxidized form of ni-fe hydrogenase

SCOP Domain Sequences for d2frvi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frvi_ e.19.1.1 (I:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

SCOP Domain Coordinates for d2frvi_:

Click to download the PDB-style file with coordinates for d2frvi_.
(The format of our PDB-style files is described here.)

Timeline for d2frvi_: