Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein Nickel-iron hydrogenase, small subunit [56772] (5 species) |
Species Desulfovibrio gigas [TaxId:879] [56773] (2 PDB entries) |
Domain d2frvg_: 2frv G: [43306] Other proteins in same PDB: d2frvb_, d2frvd_, d2frvf_, d2frvh_, d2frvj_, d2frvl_ complexed with f3s, fco, mg, ni, o, sf4 |
PDB Entry: 2frv (more details), 2.54 Å
SCOPe Domain Sequences for d2frvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frvg_ e.19.1.1 (G:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag hpciacsepnfwdlyspfysa
Timeline for d2frvg_: