Lineage for d2frvg_ (2frv G:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. Fold e.19: Nickel-iron hydrogenase, small subunit [56769] (1 superfamily)
  4. Superfamily e.19.1: Nickel-iron hydrogenase, small subunit [56770] (1 family) (S)
  5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein)
  6. Protein Nickel-iron hydrogenase, small subunit [56772] (4 species)
  7. 38643Species Desulfovibrio gigas [TaxId:879] [56773] (2 PDB entries)
  8. 38647Domain d2frvg_: 2frv G: [43306]
    Other proteins in same PDB: d2frvb_, d2frvd_, d2frvf_, d2frvh_, d2frvj_, d2frvl_

Details for d2frvg_

PDB Entry: 2frv (more details), 2.54 Å

PDB Description: crystal structure of the oxidized form of ni-fe hydrogenase

SCOP Domain Sequences for d2frvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frvg_ e.19.1.1 (G:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

SCOP Domain Coordinates for d2frvg_:

Click to download the PDB-style file with coordinates for d2frvg_.
(The format of our PDB-style files is described here.)

Timeline for d2frvg_: