Lineage for d2frve_ (2frv E:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249152Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2249153Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2249154Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2249155Protein Nickel-iron hydrogenase, small subunit [56772] (5 species)
  7. 2249163Species Desulfovibrio gigas [TaxId:879] [56773] (2 PDB entries)
  8. 2249166Domain d2frve_: 2frv E: [43305]
    Other proteins in same PDB: d2frvb_, d2frvd_, d2frvf_, d2frvh_, d2frvj_, d2frvl_
    complexed with f3s, fco, mg, ni, o, sf4

Details for d2frve_

PDB Entry: 2frv (more details), 2.54 Å

PDB Description: crystal structure of the oxidized form of ni-fe hydrogenase
PDB Compounds: (E:) periplasmic hydrogenase

SCOPe Domain Sequences for d2frve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frve_ e.19.1.1 (E:) Nickel-iron hydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]}
kkrpsvvylhnaectgcsesvlrtvdpyvdelildvismdyhetlmagaghaveealhea
ikgdfvcvieggipmgdggywgkvggrnmydicaevapkakaviaigtcatyggvqaakp
nptgtvgvnealgklgvkainiagcppnpmnfvgtvvhlltkgmpeldkqgrpvmffget
vhdncprlkhfeagefatsfgspeakkgyclyelgckgpdtynncpkqlfnqvnwpvqag
hpciacsepnfwdlyspfysa

SCOPe Domain Coordinates for d2frve_:

Click to download the PDB-style file with coordinates for d2frve_.
(The format of our PDB-style files is described here.)

Timeline for d2frve_: